RetrogeneDB ID: | retro_ocun_1717 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018806:5136..5352(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL42 | ||
| Ensembl ID: | ENSOCUG00000010928 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L42 [Source:HGNC Symbol;Acc:14493] |
| Percent Identity: | 75.34 % |
| Parental protein coverage: | 51.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AAAVMKWVISKRTILKHLSPVQNGALYCVCHKSTYSPLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEH |
| AAA..KWV.SK.TILKHLSP.QNGA.YCVCHKS.YS.LP.D.NCK.E.ALTSDGRT..C.HPSVD.P.EH | |
| Retrocopy | AAAAVKWVVSKKTILKHLSPIQNGAVYCVCHKSMYSLLPGDCNCK-EPALTSDGRTVGCCHPSVDTPNEH |
| Parental | TKP |
| T.P | |
| Retrocopy | TGP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .71 RPM |
| SRP017611_kidney | 0 .00 RPM | 24 .12 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .78 RPM |