RetrogeneDB ID: | retro_ocun_1717 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | GL018806:5136..5352(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL42 | ||
Ensembl ID: | ENSOCUG00000010928 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L42 [Source:HGNC Symbol;Acc:14493] |
Percent Identity: | 75.34 % |
Parental protein coverage: | 51.41 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AAAVMKWVISKRTILKHLSPVQNGALYCVCHKSTYSPLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEH |
AAA..KWV.SK.TILKHLSP.QNGA.YCVCHKS.YS.LP.D.NCK.E.ALTSDGRT..C.HPSVD.P.EH | |
Retrocopy | AAAAVKWVVSKKTILKHLSPIQNGAVYCVCHKSMYSLLPGDCNCK-EPALTSDGRTVGCCHPSVDTPNEH |
Parental | TKP |
T.P | |
Retrocopy | TGP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 9 .71 RPM |
SRP017611_kidney | 0 .00 RPM | 24 .12 RPM |
SRP017611_liver | 0 .00 RPM | 5 .78 RPM |