RetrogeneDB ID: | retro_ggor_2385 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 6:145038407..145038706(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000198015 | ||
| Ensembl ID: | ENSGGOG00000022760 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.12 % |
| Parental protein coverage: | 71.63 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | DYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPR-PDPVHNNEETHDQVLKTRLEEKVEHLEEGP-MI |
| D..C.V.LAL.SDGR...CYH.SVDIPYEHTKPIP...DPVHNN.ETHDQVL..RLEE..EHLE.GP..I | |
| Retrocopy | DCKCKVQLALISDGRMTLCYHRSVDIPYEHTKPIPL>TDPVHNN*ETHDQVLRVRLEE-YEHLEQGP<QI |
| Parental | EQLSKMFFTTKHRWYPHGRYH-RCRKNLNPPKDR |
| .QLSKMF.TTKH..YPHG.YH..C.K.LNPPKDR | |
| Retrocopy | DQLSKMFVTTKHC*YPHGQYH<QCHKKLNPPKDR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .24 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .97 RPM |
| SRP007412_kidney | 0 .00 RPM | 17 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .22 RPM |
| SRP007412_testis | 0 .00 RPM | 46 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009832 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002708 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000032825 | 4 retrocopies | |
| Homo sapiens | ENSG00000198015 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022760 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000013779 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016805 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005699 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010928 | 7 retrocopies | |
| Ochotona princeps | ENSOPRG00000010967 | 5 retrocopies | |
| Procavia capensis | ENSPCAG00000003791 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004833 | 7 retrocopies | |
| Pan troglodytes | ENSPTRG00000022791 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042740 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000030478 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000026544 | 12 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006370 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003312 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007658 | 1 retrocopy |