RetrogeneDB ID: | retro_ggor_2385 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 6:145038407..145038706(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000198015 | ||
Ensembl ID: | ENSGGOG00000022760 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.12 % |
Parental protein coverage: | 71.63 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | DYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPR-PDPVHNNEETHDQVLKTRLEEKVEHLEEGP-MI |
D..C.V.LAL.SDGR...CYH.SVDIPYEHTKPIP...DPVHNN.ETHDQVL..RLEE..EHLE.GP..I | |
Retrocopy | DCKCKVQLALISDGRMTLCYHRSVDIPYEHTKPIPL>TDPVHNN*ETHDQVLRVRLEE-YEHLEQGP<QI |
Parental | EQLSKMFFTTKHRWYPHGRYH-RCRKNLNPPKDR |
.QLSKMF.TTKH..YPHG.YH..C.K.LNPPKDR | |
Retrocopy | DQLSKMFVTTKHC*YPHGQYH<QCHKKLNPPKDR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .24 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .13 RPM |
SRP007412_heart | 0 .00 RPM | 2 .97 RPM |
SRP007412_kidney | 0 .00 RPM | 17 .46 RPM |
SRP007412_liver | 0 .00 RPM | 15 .22 RPM |
SRP007412_testis | 0 .00 RPM | 46 .83 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009832 | 1 retrocopy | |
Bos taurus | ENSBTAG00000002708 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000032825 | 4 retrocopies | |
Homo sapiens | ENSG00000198015 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000022760 | 5 retrocopies | |
Loxodonta africana | ENSLAFG00000013779 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016805 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005699 | 5 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000010928 | 7 retrocopies | |
Ochotona princeps | ENSOPRG00000010967 | 5 retrocopies | |
Procavia capensis | ENSPCAG00000003791 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004833 | 7 retrocopies | |
Pan troglodytes | ENSPTRG00000022791 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000042740 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000030478 | 4 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000026544 | 12 retrocopies | |
Tarsius syrichta | ENSTSYG00000006370 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000003312 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007658 | 1 retrocopy |