RetrogeneDB ID: | retro_fcat_716 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B2:86730312..86730563(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL23 | ||
| Ensembl ID: | ENSFCAG00000014502 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L23 [Source:HGNC Symbol;Acc:10316] |
| Percent Identity: | 70.59 % |
| Parental protein coverage: | 60.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LPVGAVINCADNTGAKNLYIISVKGIK-GRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSY |
| LP.GA..NC.DNT..KNL.IISV.GI..G.LNRLP.AG..D.VMA.VKKGKPELRKKV.PA.VI.Q.KSY | |
| Retrocopy | LPIGATTNCTDNTRVKNLCIISVTGIE<GQLNRLPVAGMSDRVMAIVKKGKPELRKKVYPAAVIQQQKSY |
| Parental | RRKDGVFLYFEDNAG |
| .RKDG.FLYFE...G | |
| Retrocopy | QRKDGLFLYFEESEG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 82 .18 RPM |
| SRP017611_kidney | 0 .00 RPM | 394 .09 RPM |
| SRP017611_liver | 0 .00 RPM | 158 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004268 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000008311 | 9 retrocopies | |
| Dipodomys ordii | ENSDORG00000001372 | 3 retrocopies | |
| Felis catus | ENSFCAG00000014502 | 10 retrocopies |
retro_fcat_1022, retro_fcat_1431, retro_fcat_1707, retro_fcat_1708, retro_fcat_1959, retro_fcat_242, retro_fcat_296, retro_fcat_716 , retro_fcat_756, retro_fcat_859,
|
| Homo sapiens | ENSG00000125691 | 9 retrocopies | |
| Latimeria chalumnae | ENSLACG00000004430 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004502 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000642 | 7 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000013915 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012445 | 7 retrocopies | |
| Ochotona princeps | ENSOPRG00000001957 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004107 | 10 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000014279 | 2 retrocopies |