RetrogeneDB ID: | retro_fcat_859 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B3:105154203..105154541(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL23 | ||
Ensembl ID: | ENSFCAG00000014502 | ||
Aliases: | None | ||
Description: | ribosomal protein L23 [Source:HGNC Symbol;Acc:10316] |
Percent Identity: | 58.47 % |
Parental protein coverage: | 81.43 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | NCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRR-KDGVF |
.C..NTGAK....I...G.KG..NRLPAAG.GD..M.TVKKGKPELR.KV.P.VVI.Q.KS..R.KDGVF | |
Retrocopy | DCSGNTGAK----ILGNGVKGWPNRLPAAGAGDVGMVTVKKGKPELRRKVQPRVVIQQQKSSWR<KDGVF |
Parental | LYFEDNAGVIVNNKGE---MKGSAITGPVAKECADLWPRIASNAGSIA |
L......G..VNN......MK.SAI.GPV.K.C.DLWPR..S.AG..A | |
Retrocopy | LCYDYHSGTPVNNSEP*R*MKVSAIRGPVTKVCTDLWPRTVSKAGYTA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 82 .18 RPM |
SRP017611_kidney | 0 .00 RPM | 394 .09 RPM |
SRP017611_liver | 0 .00 RPM | 158 .31 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004268 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000008311 | 9 retrocopies | |
Dipodomys ordii | ENSDORG00000001372 | 3 retrocopies | |
Felis catus | ENSFCAG00000014502 | 10 retrocopies |
retro_fcat_1022, retro_fcat_1431, retro_fcat_1707, retro_fcat_1708, retro_fcat_1959, retro_fcat_242, retro_fcat_296, retro_fcat_716, retro_fcat_756, retro_fcat_859 ,
|
Homo sapiens | ENSG00000125691 | 9 retrocopies | |
Latimeria chalumnae | ENSLACG00000004430 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004502 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000642 | 7 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000013915 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000012445 | 7 retrocopies | |
Ochotona princeps | ENSOPRG00000001957 | 10 retrocopies | |
Rattus norvegicus | ENSRNOG00000004107 | 10 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000014279 | 2 retrocopies |