RetrogeneDB ID: | retro_fcat_825 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B3:35343235..35343451(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000032037 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.84 % |
| Parental protein coverage: | 64.04 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | CIYSALILHDDEVTVTE-DKINALIKAAGVNVEPFWPGLFAKALANVNI-GSLICNV-GAGGPAPAAGAA |
| CIY..LILH.DEVTVTE.DK.N.LI.AA.V...PF.PGL.A.ALANVN..GS.IC.....GGPAPA...A | |
| Retrocopy | CIYWPLILHNDEVTVTE<DKMNVLINAAKVSAGPF*PGLCAEALANVNM<GSFICSE<KGGGPAPAGNPA |
| Parental | PAGGPA |
| P....A | |
| Retrocopy | PSTSAA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 57 .04 RPM |
| SRP017611_kidney | 0 .00 RPM | 269 .08 RPM |
| SRP017611_liver | 0 .00 RPM | 111 .70 RPM |