RetrogeneDB ID: | retro_fcat_908 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B3:75992514..75992744(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000032037 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.1 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | ASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNV-EPFWPGLFAKALANVNIGSLICNV-GAGGPA |
| A...EL...YSALIL.D.EVTV.E..I.ALI.AAGV.V..PFWPGL.AKALA.VNIGS.IC.V..AGGP. | |
| Retrocopy | AFIWELP*MYSALILYDNEVTVMEERISALIEAAGVKV>QPFWPGLSAKALADVNIGSPICVV>RAGGPV |
| Parental | PAAGAAPA |
| P...A..A | |
| Retrocopy | PCTAAVSA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 57 .04 RPM |
| SRP017611_kidney | 0 .00 RPM | 269 .08 RPM |
| SRP017611_liver | 0 .00 RPM | 111 .70 RPM |