RetrogeneDB ID: | retro_fcat_1728 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | E3:21615792..21616008(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS26 | ||
Ensembl ID: | ENSFCAG00000013977 | ||
Aliases: | None | ||
Description: | ribosomal protein S26 [Source:HGNC Symbol;Acc:10414] |
Percent Identity: | 63.89 % |
Parental protein coverage: | 62.61 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | NIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPP |
N..EA..VRDIS..SV..A.VLP.L.VK.H.C.SCA...K.VRNRS..A..DRTPPP..RPAGAAP.P.P | |
Retrocopy | NMAEATLVRDISKVSVLGACVLPRLHVKPHSCLSCAVSGKTVRNRSGTAQEDRTPPPQLRPAGAAP*PSP |
Parental | KP |
KP | |
Retrocopy | KP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 39 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 119 .55 RPM |
SRP017611_liver | 0 .00 RPM | 78 .95 RPM |