RetrogeneDB ID: | retro_mmul_1944 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 5:46804421..46804658(-) | ||
Located in intron of: | ENSMMUG00000000866 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS26 | ||
Ensembl ID: | ENSMMUG00000017042 | ||
Aliases: | None | ||
Description: | 40S ribosomal protein S26 [Source:RefSeq peptide;Acc:NP_001180510] |
Percent Identity: | 72.15 % |
Parental protein coverage: | 66.96 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | FVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDR--TPPPRFRPAGA |
F.I.N.VEAAA.RDISEAS.FDAYVL.KLYVKLH.CV.CAIHSKVV.N.S.E.RKD.....PPRF..A.A | |
Retrocopy | FII*NMVEAAAFRDISEASIFDAYVLSKLYVKLHHCVNCAIHSKVVKNLSHEGRKDQESNTPPRFTSASA |
Parental | APRPPPKPM |
AP.PP.KPM | |
Retrocopy | APQPP*KPM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 14 .01 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 105 .51 RPM |
SRP007412_cerebellum | 0 .06 RPM | 16 .08 RPM |
SRP007412_heart | 0 .00 RPM | 46 .93 RPM |
SRP007412_kidney | 0 .00 RPM | 32 .75 RPM |
SRP007412_liver | 0 .00 RPM | 115 .55 RPM |
SRP007412_testis | 0 .04 RPM | 31 .74 RPM |