RetrogeneDB ID: | retro_fcat_1851 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | F2:48219664..48219889(-) | ||
Located in intron of: | ENSFCAG00000005022 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS26 | ||
Ensembl ID: | ENSFCAG00000013977 | ||
Aliases: | None | ||
Description: | ribosomal protein S26 [Source:HGNC Symbol;Acc:10414] |
Percent Identity: | 86.84 % |
Parental protein coverage: | 66.09 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | FVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAP |
FVI.NIVEAAAV.DISEASV.DA.VLPKLYVKLHYCVSCAIH.KVVRNRS.EARKDRTPPPRFR.A.AAP | |
Retrocopy | FVIQNIVEAAAVKDISEASV-DA*VLPKLYVKLHYCVSCAIHNKVVRNRSHEARKDRTPPPRFRSAAAAP |
Parental | RPPPKP |
.PP.KP | |
Retrocopy | QPPSKP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .23 RPM | 39 .94 RPM |
SRP017611_kidney | 0 .10 RPM | 119 .55 RPM |
SRP017611_liver | 0 .00 RPM | 78 .95 RPM |