RetrogeneDB ID: | retro_fcat_1174 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:40240720..40240937(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000014455 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.63 % |
| Parental protein coverage: | 73.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPE-YGGTKVVLDDKDYFLFRDGDI |
| .GGIMLPEKS..KVLQATVV..GS.SKG..GEI..V.VKVG.KVLLPE..GGT..VLDDKDYFLF.DGDI | |
| Retrocopy | RGGIMLPEKSKRKVLQATVVTIGSCSKG--GEISTV-VKVGEKVLLPE>NGGTRAVLDDKDYFLFKDGDI |
| Parental | LGKYVD |
| LGKYVD | |
| Retrocopy | LGKYVD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 25 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 160 .87 RPM |
| SRP017611_liver | 0 .00 RPM | 105 .54 RPM |