RetrogeneDB ID: | retro_mmus_1597 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 17:84307322..84307506(+) | ||
Located in intron of: | ENSMUSG00000024251 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Snrpe | ||
Ensembl ID: | ENSMUSG00000090553 | ||
Aliases: | Snrpe, AL022645, C76690, SME | ||
Description: | small nuclear ribonucleoprotein E [Source:MGI Symbol;Acc:MGI:98346] |
Percent Identity: | 69.35 % |
Parental protein coverage: | 67.03 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | YRGQGQKVQKVMVQP-INLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEE |
Y..QG..VQKV.V.P.INLIFR.LQNRS.IQVWL..QV....EGC..GFDEYMNLVL.D.EE | |
Retrocopy | YLDQGHEVQKVAVRP>INLIFRKLQNRSLIQVWLCAQVSVLTEGCATGFDEYMNLVLNDIEE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .05 RPM | 11 .21 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .25 RPM |
SRP007412_heart | 0 .00 RPM | 11 .61 RPM |
SRP007412_kidney | 0 .00 RPM | 14 .80 RPM |
SRP007412_liver | 0 .00 RPM | 11 .14 RPM |
SRP007412_testis | 0 .00 RPM | 9 .88 RPM |