RetrogeneDB ID: | retro_mmus_3682 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | X:105989903..105990124(-) | ||
Located in intron of: | ENSMUSG00000031232 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Snrpe | ||
Ensembl ID: | ENSMUSG00000090553 | ||
Aliases: | Snrpe, AL022645, C76690, SME | ||
Description: | small nuclear ribonucleoprotein E [Source:MGI Symbol;Acc:MGI:98346] |
Percent Identity: | 78.67 % |
Parental protein coverage: | 80.43 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | NLIFRYLQNRSRIQVWLYEQVNMRIEG-CIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLL |
N.IFRYLQNR..I.V.LYEQVN.RIEG..IIGFD...NL.LDDAEE.HSKTKS.KQLGRI.LKGDN.TLL | |
Retrocopy | NRIFRYLQNRI*IHVCLYEQVNIRIEG<LIIGFDKCTNLKLDDAEEVHSKTKSGKQLGRIVLKGDNTTLL |
Parental | QSVSN |
QSVSN | |
Retrocopy | QSVSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 11 .21 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .25 RPM |
SRP007412_heart | 0 .06 RPM | 11 .61 RPM |
SRP007412_kidney | 0 .06 RPM | 14 .80 RPM |
SRP007412_liver | 0 .00 RPM | 11 .14 RPM |
SRP007412_testis | 0 .00 RPM | 9 .88 RPM |