RetrogeneDB ID: | retro_pvam_1478 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | scaffold_9571:27717..27922(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSPVAG00000000921 | ||
Aliases: | None | ||
Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
Percent Identity: | 54.17 % |
Parental protein coverage: | 68.27 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | YHLQKSTCGKCGY-PAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS |
YHL.KSTCGKC...P.K.K.K...SAKAK..N.T.TG.MR...IV..R....F..G.TPK...A.V.A.S | |
Retrocopy | YHLEKSTCGKCYL>PSKCKEKV*PSAKAK*SNATSTGQMR---IVSHRSKYEFPKGITPKSEKAVVTAPS |
Parental | SS |
SS | |
Retrocopy | SS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |