RetrogeneDB ID: | retro_ggor_1002 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 13:50866142..50866348(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSGGOG00000003241 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 54.93 % |
Parental protein coverage: | 65.38 % |
Number of stop codons detected: | 6 |
Number of frameshifts detected | 1 |
Parental | LQKSTCG-KCGYPAKRKRKY--NWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS |
L..STC..K.G.PA..K.KY..N...KAK..N..GTG...HLK.VYRRFRH....GTT.....AAVAA.S | |
Retrocopy | LMVSTC*<K*G*PANHKQKY*RNCNMKAKQQNAIGTG*IKHLKFVYRRFRHRCSAGTT-*CQEAAVAAPS |
Parental | S |
S | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 82 .53 RPM |
SRP007412_cerebellum | 0 .00 RPM | 113 .70 RPM |
SRP007412_heart | 0 .00 RPM | 51 .72 RPM |
SRP007412_kidney | 0 .00 RPM | 291 .86 RPM |
SRP007412_liver | 0 .00 RPM | 406 .30 RPM |
SRP007412_testis | 0 .00 RPM | 148 .25 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1277 |
Pan troglodytes | retro_ptro_873 |
Pongo abelii | retro_pabe_1058 |
Equus caballus | retro_ecab_420 |