RetrogeneDB ID: | retro_ggor_1002 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 13:50866142..50866348(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSGGOG00000003241 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.93 % |
| Parental protein coverage: | 65.38 % |
| Number of stop codons detected: | 6 |
| Number of frameshifts detected: | 1 |
| Parental | LQKSTCG-KCGYPAKRKRKY--NWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS |
| L..STC..K.G.PA..K.KY..N...KAK..N..GTG...HLK.VYRRFRH....GTT.....AAVAA.S | |
| Retrocopy | LMVSTC*<K*G*PANHKQKY*RNCNMKAKQQNAIGTG*IKHLKFVYRRFRHRCSAGTT-*CQEAAVAAPS |
| Parental | S |
| S | |
| Retrocopy | S |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 82 .53 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 113 .70 RPM |
| SRP007412_heart | 0 .00 RPM | 51 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 291 .86 RPM |
| SRP007412_liver | 0 .00 RPM | 406 .30 RPM |
| SRP007412_testis | 0 .00 RPM | 148 .25 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1277 |
| Pan troglodytes | retro_ptro_873 |
| Pongo abelii | retro_pabe_1058 |
| Equus caballus | retro_ecab_420 |