RetrogeneDB ID: | retro_ggor_2246 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 5:35180439..35180637(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSGGOG00000003241 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 84.85 % |
Parental protein coverage: | 63.46 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | STCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASSSS |
STCGKCGYPAK.KRKYNWSA.A.R.N.TGTGRMRHLK.VY.RFRHGFRE.TTPK.KRAAVAAS.SS | |
Retrocopy | STCGKCGYPAKHKRKYNWSAEAQRCNATGTGRMRHLKAVYHRFRHGFREETTPKHKRAAVAASESS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 82 .53 RPM |
SRP007412_cerebellum | 0 .04 RPM | 113 .70 RPM |
SRP007412_heart | 0 .00 RPM | 51 .72 RPM |
SRP007412_kidney | 0 .12 RPM | 291 .86 RPM |
SRP007412_liver | 0 .18 RPM | 406 .30 RPM |
SRP007412_testis | 0 .10 RPM | 148 .25 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1763 |
Pan troglodytes | retro_ptro_1208 |
Pongo abelii | retro_pabe_1532 |
Callithrix jacchus | retro_cjac_2654 |