RetrogeneDB ID: | retro_dnov_529 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_5786:5180..5636(-) | ||
| Located in intron of: | ENSDNOG00000010265 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LDHB | ||
| Ensembl ID: | ENSDNOG00000013620 | ||
| Aliases: | None | ||
| Description: | lactate dehydrogenase B [Source:HGNC Symbol;Acc:6541] |
| Percent Identity: | 76.97 % |
| Parental protein coverage: | 52.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LTDELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKVVVVTAGVRQQEGESRLNLVQRN |
| L.DE.AL.DV.EDKLKGEMM.LQHG.LFL.TPKIV..KDYSVTANSK.V..TAG.RQQE.ESRLNLVQ.N | |
| Retrocopy | LADEFALADVIEDKLKGEMMGLQHGTLFLRTPKIVSGKDYSVTANSKLVIFTAGARQQERESRLNLVQHN |
| Parental | VNVFKFIIPQIIKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVFGSGCNLDSARFRYLMAEKLGVHPT |
| VN.FKFIIP...KYSP.C....V.NPVDILTYV.WKLSG.PK.RV.GSGCNLDSARF.YLM.E.LGVHP. | |
| Retrocopy | VNIFKFIIPNVVKYSPNCKLLIVPNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFHYLMGEWLGVHPS |
| Parental | SCHGWILGEHGD |
| SCHGW.LGE.GD | |
| Retrocopy | SCHGWVLGECGD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .97 RPM | 299 .29 RPM |
| SRP012922_cerebellum | 1 .51 RPM | 408 .56 RPM |
| SRP012922_heart | 0 .23 RPM | 1695 .69 RPM |
| SRP012922_kidney | 1 .10 RPM | 900 .24 RPM |
| SRP012922_liver | 0 .31 RPM | 13 .47 RPM |
| SRP012922_lung | 0 .76 RPM | 184 .19 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 987 .97 RPM |
| SRP012922_spleen | 0 .69 RPM | 156 .93 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016175 | 4 retrocopies | |
| Canis familiaris | ENSCAFG00000012195 | 9 retrocopies | |
| Cavia porcellus | ENSCPOG00000007138 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000013620 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000018915 | 11 retrocopies | |
| Felis catus | ENSFCAG00000012639 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015758 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000972 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004825 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000017183 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002679 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000017786 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000172 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000030246 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004763 | 9 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002462 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013000 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000000576 | 1 retrocopy |