RetrogeneDB ID: | retro_mmus_1360 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 15:77811970..77812167(+) | ||
Located in intron of: | ENSMUSG00000022443 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rpl37 | ||
Ensembl ID: | ENSMUSG00000041841 | ||
Aliases: | Rpl37, 3110005M08Rik | ||
Description: | ribosomal protein L37 [Source:MGI Symbol;Acc:MGI:1914531] |
Percent Identity: | 60.29 % |
Parental protein coverage: | 69.07 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | KSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGR-MRHLKIVYRRFRHGFREGTTPKPKRAAVAASSSS |
...CGK.G.PAK...KYNWS.KA.R.N..G....MR.LKIVY.RFRHG...G...KPKRAA.AAS.SS | |
Retrocopy | RAHCGKYG-PAKCEGKYNWSGKAERQNDPGASK<MRPLKIVYGRFRHGVCDGEISKPKRAADAASASS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 65 .70 RPM |
SRP007412_cerebellum | 0 .00 RPM | 37 .21 RPM |
SRP007412_heart | 0 .03 RPM | 58 .93 RPM |
SRP007412_kidney | 0 .02 RPM | 45 .29 RPM |
SRP007412_liver | 0 .00 RPM | 67 .59 RPM |
SRP007412_testis | 0 .00 RPM | 51 .18 RPM |
ENCODE library ID | Target | ChIP-Seq Peak coordinates |
---|---|---|
ENCFF001XVA | POLR2A | 15:77809933..77811344 |
ENCFF001XVA | POLR2A | 15:77811411..77811823 |
ENCFF001YKA | POLR2A | 15:77811482..77811617 |
Experiment type: | PCR amplification |
---|---|
Forward primer: | GCTTTAGCAGCATATTCAAAC (21 nt long) |
Reverse primer: | ACATTGTTTTATGATTGATCAG (22 nt long) |
Anneling temperature: | 50 °C |
(Expected) product size: | 402 |
Electrophoresis gel image: | ![]() |
Additional comment: | Pfu DNA Polymerase; pooled mouse cDNA; 40 cycles of PCR |