RetrogeneDB ID: | retro_mmus_2385 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:110510065..110510302(+) | ||
| Located in intron of: | ENSMUSG00000061298 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081813 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl37 | ||
| Ensembl ID: | ENSMUSG00000041841 | ||
| Aliases: | Rpl37, 3110005M08Rik | ||
| Description: | ribosomal protein L37 [Source:MGI Symbol;Acc:MGI:1914531] |
| Percent Identity: | 69.14 % |
| Parental protein coverage: | 81.44 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KRRNKTHTLCRRCGSKAY-HLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHL-KIVYRRFRHG |
| K...K.H.LC..CGSKA...LQKST.GKC.YPAK.KR.YN.SAK.KRRNT..TGR.RH..KIVYRRFR.. | |
| Retrocopy | KHHTKMHLLCCCCGSKAS>YLQKSTYGKCDYPAKCKREYN*SAKVKRRNTIATGRIRHQ<KIVYRRFRYR |
| Parental | FREGTTPKPKR |
| F.EGTTPK.KR | |
| Retrocopy | FHEGTTPKHKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 65 .70 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 58 .93 RPM |
| SRP007412_kidney | 0 .00 RPM | 45 .29 RPM |
| SRP007412_liver | 0 .00 RPM | 67 .59 RPM |
| SRP007412_testis | 0 .05 RPM | 51 .18 RPM |