RetrogeneDB ID: | retro_mmus_2811 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 6:34810633..34810821(-) | ||
| Located in intron of: | ENSMUSG00000038836 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000082118 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl37 | ||
| Ensembl ID: | ENSMUSG00000041841 | ||
| Aliases: | Rpl37, 3110005M08Rik | ||
| Description: | ribosomal protein L37 [Source:MGI Symbol;Acc:MGI:1914531] |
| Percent Identity: | 93.75 % |
| Parental protein coverage: | 64.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GKCGYPAKRKRKYNWSAKAKRRNTTG-TGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASSSS |
| GKCGYPAKRKRKYNWSAKAKR.NTTG.TG.MRHLKIVYRRFRHGF.EGTTPKPKRAAVAASSSS | |
| Retrocopy | GKCGYPAKRKRKYNWSAKAKRGNTTG<TGQMRHLKIVYRRFRHGFHEGTTPKPKRAAVAASSSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 65 .70 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 58 .93 RPM |
| SRP007412_kidney | 0 .04 RPM | 45 .29 RPM |
| SRP007412_liver | 0 .00 RPM | 67 .59 RPM |
| SRP007412_testis | 0 .14 RPM | 51 .18 RPM |