RetrogeneDB ID: | retro_ptro_1451 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 21:6032875..6033111(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSPTRG00000016822 | ||
Aliases: | None | ||
Description: | Pan troglodytes ribosomal protein L37 (RPL37), mRNA. [Source:RefSeq mRNA;Acc:NM_001246471] |
Percent Identity: | 75.9 % |
Parental protein coverage: | 82.47 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | LCRRCG-SKAYHLQK-STCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPK |
LC..CG.SK.YHLQK..TCGKCGY.AK..RKYNWSAKAKR.NTTGTG.MR.LKIVY.RFRHGF.E..TPK | |
Retrocopy | LCHHCG<SKIYHLQK<VTCGKCGYSAKHGRKYNWSAKAKRQNTTGTG*MRQLKIVYSRFRHGFHE-ETPK |
Parental | PKRAA-VAASSSS |
PKRAA..A.S.SS | |
Retrocopy | PKRAA>LAESNSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 186 .20 RPM |
SRP007412_cerebellum | 0 .00 RPM | 129 .27 RPM |
SRP007412_heart | 0 .00 RPM | 107 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 357 .44 RPM |
SRP007412_liver | 0 .03 RPM | 210 .97 RPM |
SRP007412_testis | 0 .00 RPM | 46 .90 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2499 |
Gorilla gorilla | retro_ggor_1558 |
Pongo abelii | retro_pabe_1840 |
Macaca mulatta | retro_mmul_1672 |