RetrogeneDB ID: | retro_ptro_1584 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 2A:27048404..27048650(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSPTRG00000016822 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes ribosomal protein L37 (RPL37), mRNA. [Source:RefSeq mRNA;Acc:NM_001246471] |
| Percent Identity: | 79.27 % |
| Parental protein coverage: | 84.54 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | THTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTP |
| TH.LCR.CG.KAYHLQK.TCGKCGY.AK..RKYNWSAKAKR.NTT.TG..RHLKI.Y..FRHGF.EGTTP | |
| Retrocopy | THMLCRCCGCKAYHLQKLTCGKCGYLAKCERKYNWSAKAKRQNTTRTG*IRHLKIIYHTFRHGFHEGTTP |
| Parental | KPKRAAVAASSS |
| KPKRAAV..SSS | |
| Retrocopy | KPKRAAVTTSSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 186 .20 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 129 .27 RPM |
| SRP007412_heart | 0 .00 RPM | 107 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 357 .44 RPM |
| SRP007412_liver | 0 .00 RPM | 210 .97 RPM |
| SRP007412_testis | 0 .00 RPM | 46 .90 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2239 |
| Gorilla gorilla | retro_ggor_1670 |
| Pongo abelii | retro_pabe_1967 |