RetrogeneDB ID: | retro_ptro_873 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 13:68139121..68139327(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSPTRG00000016822 | ||
Aliases: | None | ||
Description: | Pan troglodytes ribosomal protein L37 (RPL37), mRNA. [Source:RefSeq mRNA;Acc:NM_001246471] |
Percent Identity: | 54.93 % |
Parental protein coverage: | 70.1 % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 1 |
Parental | LQKSTCG-KCGYPAKRKRKY--NWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS |
L..STC..K.GYPA..K.KY..N...KAK..N...TG...HLK.VYRRFRH....GTT.....AAVAA.S | |
Retrocopy | LMVSTC*<K*GYPANHKQKY*CNCNMKAKQQNAISTG*IKHLKFVYRRFRHRCSAGTT-*CQEAAVAAPS |
Parental | S |
S | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 186 .20 RPM |
SRP007412_cerebellum | 0 .00 RPM | 129 .27 RPM |
SRP007412_heart | 0 .00 RPM | 107 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 357 .44 RPM |
SRP007412_liver | 0 .00 RPM | 210 .97 RPM |
SRP007412_testis | 0 .00 RPM | 46 .90 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1277 |
Gorilla gorilla | retro_ggor_1002 |
Pongo abelii | retro_pabe_1058 |
Equus caballus | retro_ecab_420 |