RetrogeneDB ID: | retro_pabe_1443 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 17:29814055..29814274(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSPPYG00000015422 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
| Percent Identity: | 80.82 % |
| Parental protein coverage: | 75.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAAS |
| ..YHLQKSTC.K.GY.AKRKRKYNWSAKAK..NTTGTG.MRHLKIVY.RFRHGF.E.T.PKPKRA..AAS | |
| Retrocopy | RTYHLQKSTCSKRGYVAKRKRKYNWSAKAKGQNTTGTGQMRHLKIVYSRFRHGFCERTPPKPKRATAAAS |
| Parental | SSS |
| SSS | |
| Retrocopy | SSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 62 .42 RPM |
| SRP007412_cerebellum | 0 .24 RPM | 60 .68 RPM |
| SRP007412_heart | 0 .00 RPM | 63 .73 RPM |
| SRP007412_kidney | 0 .13 RPM | 73 .02 RPM |
| SRP007412_liver | 0 .03 RPM | 81 .68 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1747 |
| Pan troglodytes | retro_ptro_1219 |