RetrogeneDB ID: | retro_ptro_1208 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 17:8693696..8693894(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSPTRG00000016822 | ||
Aliases: | None | ||
Description: | Pan troglodytes ribosomal protein L37 (RPL37), mRNA. [Source:RefSeq mRNA;Acc:NM_001246471] |
Percent Identity: | 86.36 % |
Parental protein coverage: | 68.04 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | STCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASSSS |
STCGKCGYPAK.KRKYNWSAKA.R.N.TGTGRMRHLK.VY.RFRHGFRE.TTPK.KRAAVAAS.SS | |
Retrocopy | STCGKCGYPAKHKRKYNWSAKAQR*NATGTGRMRHLKAVYHRFRHGFREETTPKHKRAAVAASESS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 186 .20 RPM |
SRP007412_cerebellum | 0 .04 RPM | 129 .27 RPM |
SRP007412_heart | 0 .00 RPM | 107 .00 RPM |
SRP007412_kidney | 0 .08 RPM | 357 .44 RPM |
SRP007412_liver | 0 .00 RPM | 210 .97 RPM |
SRP007412_testis | 0 .00 RPM | 46 .90 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1763 |
Gorilla gorilla | retro_ggor_2246 |
Pongo abelii | retro_pabe_1532 |
Callithrix jacchus | retro_cjac_2654 |