RetrogeneDB ID: | retro_ecab_754 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 30:29768984..29769215(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSECAG00000016621 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 55. % |
Parental protein coverage: | 52.98 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RIPGFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSS |
R.P.FN...............AGDI.D.LL...DFL.FK.MFLDYRAEK.G..L.LSSGLV.TSLCKSSS | |
Retrocopy | RLPEFNVVV---SKHYSSQKMAGDILDRLLPCMDFLSFKDMFLDYRAEKGGLALGLSSGLVATSLCKSSS |
Parental | VPASQNSLRP |
....Q..L.P | |
Retrocopy | QDTLQH*LSP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 47 .87 RPM |
SRP021940_cerebellum | 0 .00 RPM | 109 .53 RPM |
SRP021940_embryo | 0 .08 RPM | 61 .40 RPM |
SRP021940_placental_villous | 0 .00 RPM | 32 .91 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 48 .32 RPM |
SRP021940_testis | 0 .13 RPM | 174 .12 RPM |