RetrogeneDB ID: | retro_pcap_360 | ||
Retrocopy location | Organism: | Hyrax (Procavia capensis) | |
| Coordinates: | scaffold_48819:8395..8619(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS4X | ||
| Ensembl ID: | ENSPCAG00000000761 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S4, X-linked [Source:HGNC Symbol;Acc:10424] |
| Percent Identity: | 53.95 % |
| Parental protein coverage: | 56.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EVKKICMQRFIKIDGKVRTDITYPAGFM-DVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRK |
| E.KKIC...FI....KV.T..TY......DVISI.KT.E.F.L..D.KG..AV..I.P.EAKYKL.K.RK | |
| Retrocopy | EMKKICTW*FIGMESKVCTNVTYSVELR<DVISITKTRESFCLTCDAKGHCAVYHIRPGEAKYKLYKMRK |
| Parental | IFVGTK |
| I...TK | |
| Retrocopy | IAACTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |