RetrogeneDB ID: | retro_fcat_834 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B3:49573654..49573884(+) | ||
Located in intron of: | ENSFCAG00000031674 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | POMP | ||
Ensembl ID: | ENSFCAG00000008235 | ||
Aliases: | None | ||
Description: | proteasome maturation protein [Source:HGNC Symbol;Acc:20330] |
Percent Identity: | 74.68 % |
Parental protein coverage: | 54.61 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | NARGLGSQLKDSIPVTELSASGPFESHDLL-RKGLPCVKNE-LLPSHPLELLFKGFQLNQDKMNFSTLRN |
.ARGLGSQLKDSIPVTELS.SGPFESHDLL..KG.P..KN..LL.S.PLEL..K.FQL..DKM.FSTLR. | |
Retrocopy | DARGLGSQLKDSIPVTELSVSGPFESHDLL>KKGFPRIKND>LL-SYPLELSKKNFQLK*DKMTFSTLRH |
Parental | IQGLFAPLK |
IQGL.APL. | |
Retrocopy | IQGLCAPLE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 28 .92 RPM |
SRP017611_kidney | 0 .00 RPM | 33 .60 RPM |
SRP017611_liver | 0 .00 RPM | 24 .97 RPM |