RetrogeneDB ID: | retro_cjac_4191 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:74381821..74382040(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POMP | ||
| Ensembl ID: | ENSCJAG00000019473 | ||
| Aliases: | None | ||
| Description: | proteasome maturation protein [Source:HGNC Symbol;Acc:20330] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 51.77 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | SGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQG-LFAPLKLQME-FKAVQQV |
| S...ESH.L....F.CVKNELLP.HPLE....NFQLN.DKMN.STLRNI...LFAPLKL.ME.FKAVQ.. | |
| Retrocopy | SSSAESHNLHKRFFVCVKNELLPGHPLEFLHENFQLNRDKMNISTLRNIRS<LFAPLKL*ME>FKAVQKF |
| Parental | QRLPF |
| Q.L.F | |
| Retrocopy | QCLLF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 27 .96 RPM |
| SRP051959_heart | 0 .00 RPM | 20 .59 RPM |
| SRP051959_kidney | 0 .00 RPM | 20 .41 RPM |
| SRP051959_liver | 0 .00 RPM | 25 .47 RPM |
| SRP051959_lung | 0 .00 RPM | 18 .41 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 17 .12 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 34 .39 RPM |
| SRP051959_spleen | 0 .00 RPM | 23 .26 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4866 |
| Gorilla gorilla | retro_ggor_3038 |
| Pongo abelii | retro_pabe_3783 |
| Macaca mulatta | retro_mmul_2603 |