RetrogeneDB ID: | retro_fcat_876 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B3:138576329..138576559(+) | ||
Located in intron of: | ENSFCAG00000010233 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBA52 | ||
Ensembl ID: | ENSFCAG00000009745 | ||
Aliases: | UBA52, CEP52, UBCEP2 | ||
Description: | Ubiquitin-60S ribosomal protein L40 Ubiquitin 60S ribosomal protein L40 [Source:UniProtKB/Swiss-Prot;Acc:P63052] |
Percent Identity: | 55.7 % |
Parental protein coverage: | 60.94 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LIFAGKQLEDGRTLSDYNIQKES-TLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCR |
L.FAGKQLEDGR.LS.Y..Q.ES.TL.....L.GGI..PS.RQ.AQ....DK.IC.KC..RL.P.AV..R | |
Retrocopy | LSFAGKQLEDGRPLSGYDVQEES<TLCSLCHLGGGIAGPSHRQPAQEWDYDKVICCKCRSRLGPHAVT-R |
Parental | KKKCGHTNN |
.K.C....N | |
Retrocopy | HKHCSPRRN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 56 .81 RPM |
SRP017611_kidney | 0 .00 RPM | 162 .11 RPM |
SRP017611_liver | 0 .00 RPM | 106 .65 RPM |