RetrogeneDB ID: | retro_ptro_3135 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | X:77583913..77584123(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP5 | ||
Ensembl ID: | ENSPTRG00000020373 | ||
Aliases: | FABP5, FABP5L2, FABP5L7 | ||
Description: | fatty acid binding protein 5 (psoriasis-associated) [Source:HGNC Symbol;Acc:3560] |
Percent Identity: | 66.2 % |
Parental protein coverage: | 52.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEK |
QFS.....K.EETT..GRKTQTV..FT..ALVQHQE..GKEST..RK.KDGKL.VECVM.N.T..RI..K | |
Retrocopy | QFSYKPEKKSEETTDYGRKTQTVYKFTNDALVQHQERNGKESTM-RKVKDGKLTVECVMYNATSPRIHKK |
Parental | V |
V | |
Retrocopy | V |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .25 RPM |
SRP007412_cerebellum | 0 .00 RPM | 8 .64 RPM |
SRP007412_heart | 0 .00 RPM | 19 .18 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .76 RPM |
SRP007412_liver | 0 .00 RPM | 1 .18 RPM |
SRP007412_testis | 0 .00 RPM | 20 .87 RPM |