RetrogeneDB ID: | retro_ptro_2131 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 5:19364295..19364541(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP5 | ||
| Ensembl ID: | ENSPTRG00000020373 | ||
| Aliases: | FABP5, FABP5L2, FABP5L7 | ||
| Description: | fatty acid binding protein 5 (psoriasis-associated) [Source:HGNC Symbol;Acc:3560] |
| Percent Identity: | 74.39 % |
| Parental protein coverage: | 60.74 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | IKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMN |
| I.TESTLK.TQFSCTL.EKFEETTA..RK.QTV.NF..G.LVQHQEW.GKESTITRKLK.GKL.V....N | |
| Retrocopy | INTESTLKPTQFSCTLVEKFEETTANSRKPQTVHNFIHGTLVQHQEWKGKESTITRKLKNGKLMVDRILN |
| Parental | NVTCTRIYEKVE |
| NVTCT..Y.K.E | |
| Retrocopy | NVTCTQVYKKEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .25 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .64 RPM |
| SRP007412_heart | 0 .00 RPM | 19 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .18 RPM |
| SRP007412_testis | 0 .00 RPM | 20 .87 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3357 |
| Gorilla gorilla | retro_ggor_2276 |
| Macaca mulatta | retro_mmul_2095 |
| Callithrix jacchus | retro_cjac_1832 |