RetrogeneDB ID: | retro_cpor_1137 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_5:29875281..29875634(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTP4A1 | ||
Ensembl ID: | ENSCPOG00000025759 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 55.37 % |
Parental protein coverage: | 69.36 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | PAPVEVTYKSMRFLITHNP-TNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVFDWPFDDGAP |
P.PVEVTYK.M.F.I...P.T..TLNKF.EELK.Y..T.IVRV......T.LVEKE.......PFDDGA. | |
Retrocopy | PDPVEVTYKNMGFFIANSP<THTTLNKFVEELK-YSITIIVRVSVNNQGTALVEKESVCILHCPFDDGAK |
Parental | PSNQIVDDWLNLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKY |
...QIV.D......I.F.EE..CCIA...VAGL.R.PV.V.L..IEGGM.Y | |
Retrocopy | LFIQIVYDCVSPINIQFHEE-SCCIAISFVAGLWRVPVFVGLT*IEGGMIY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 27 .44 RPM |
SRP017611_kidney | 0 .00 RPM | 23 .45 RPM |
SRP017611_liver | 0 .00 RPM | 21 .28 RPM |
SRP040447_lung | 0 .00 RPM | 27 .29 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 37 .03 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002275 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000025759 | 5 retrocopies | |
Echinops telfairi | ENSETEG00000008183 | 6 retrocopies | |
Latimeria chalumnae | ENSLACG00000007183 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000006572 | 8 retrocopies | |
Myotis lucifugus | ENSMLUG00000001162 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002777 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000018701 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000440 | 6 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006311 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000004938 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000016743 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000011771 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000046370 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000009956 | 14 retrocopies | |
Tursiops truncatus | ENSTTRG00000004129 | 6 retrocopies | |
Vicugna pacos | ENSVPAG00000004277 | 9 retrocopies |