RetrogeneDB ID: | retro_nleu_2949 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397508.1:297113..297527(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CDC42 | ||
Ensembl ID: | ENSNLEG00000008198 | ||
Aliases: | None | ||
Description: | cell division cycle 42 [Source:HGNC Symbol;Acc:1736] |
Percent Identity: | 82.61 % |
Parental protein coverage: | 72.25 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDD |
..LFDTAGQEDYDRL..LSY.QTDVF.VCFSVVSPSSFENVK.KWV.EITHHCPKT.FLLVGTQID.RDD | |
Retrocopy | ISLFDTAGQEDYDRL*LLSYLQTDVFPVCFSVVSPSSFENVKGKWVSEITHHCPKTHFLLVGTQIDFRDD |
Parental | PSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRKCCI |
.STIEKLA.NKQKPITPETAEKL.RDLKAV.YVECSALTQ.GLKNVFDE.I.AALEPPE....R.C.. | |
Retrocopy | LSTIEKLARNKQKPITPETAEKLIRDLKAVRYVECSALTQKGLKNVFDEEIVAALEPPELKKSRRCVL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000014707 | 5 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000005306 | 10 retrocopies | |
Callithrix jacchus | ENSCJAG00000005912 | 6 retrocopies | |
Cavia porcellus | ENSCPOG00000006543 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000004443 | 1 retrocopy | |
Felis catus | ENSFCAG00000004853 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000022009 | 8 retrocopies | |
Monodelphis domestica | ENSMODG00000016078 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000015999 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008198 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000014759 | 7 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000009986 | 1 retrocopy | |
Sorex araneus | ENSSARG00000005184 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000000805 | 4 retrocopies | |
Vicugna pacos | ENSVPAG00000006919 | 3 retrocopies |