RetrogeneDB ID: | retro_ggor_1872 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 3:105975106..105975306(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FCF1 | ||
Ensembl ID: | ENSGGOG00000016318 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 83.82 % |
Parental protein coverage: | 55.37 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MGKQKKT-RKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPY |
MGKQ.KT.RKYATMKRMLSLRDQRLKE.DRLK..KKEK..PS.LK.R.VPQHPS.LFFQYNTQLGPPY | |
Retrocopy | MGKQNKT<RKYATMKRMLSLRDQRLKE*DRLKHEKKEK*YPSMLKKRKVPQHPSWLFFQYNTQLGPPY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .55 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .03 RPM |
SRP007412_heart | 0 .00 RPM | 0 .66 RPM |
SRP007412_kidney | 0 .00 RPM | 4 .09 RPM |
SRP007412_liver | 0 .00 RPM | 1 .71 RPM |
SRP007412_testis | 0 .10 RPM | 7 .36 RPM |