RetrogeneDB ID: | retro_sara_155 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | GeneScaffold_4924:213196..213402(+) | ||
| Located in intron of: | ENSSARG00000012208 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL21 | ||
| Ensembl ID: | ENSSARG00000013129 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L21 [Source:HGNC Symbol;Acc:10313] |
| Percent Identity: | 52.05 % |
| Parental protein coverage: | 53.73 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | YMRIYKKGDIVD-IKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRIHAPRENIKH |
| ...IY.KG.IV...K.M.TVQKGM..KCY.......Y..TQH.VG.V...Q.KG...AKRIH.....IKH | |
| Retrocopy | HIYIYQKGEIVY<LKEMLTVQKGMYYKCYYDEK-LAYSSTQHVVGLV--NQTKGMSIAKRIHIYIRYIKH |
| Parental | SEN |
| SEN | |
| Retrocopy | SEN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |