RetrogeneDB ID: | retro_sara_155 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | GeneScaffold_4924:213196..213402(+) | ||
Located in intron of: | ENSSARG00000012208 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL21 | ||
Ensembl ID: | ENSSARG00000013129 | ||
Aliases: | None | ||
Description: | ribosomal protein L21 [Source:HGNC Symbol;Acc:10313] |
Percent Identity: | 52.05 % |
Parental protein coverage: | 53.73 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | YMRIYKKGDIVD-IKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRIHAPRENIKH |
...IY.KG.IV...K.M.TVQKGM..KCY.......Y..TQH.VG.V...Q.KG...AKRIH.....IKH | |
Retrocopy | HIYIYQKGEIVY<LKEMLTVQKGMYYKCYYDEK-LAYSSTQHVVGLV--NQTKGMSIAKRIHIYIRYIKH |
Parental | SEN |
SEN | |
Retrocopy | SEN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |