RetrogeneDB ID: | retro_dnov_1725 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_27740:1492..1729(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP5H | ||
Ensembl ID: | ENSDNOG00000006913 | ||
Aliases: | None | ||
Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [Source:HGNC Symbol;Acc:845] |
Percent Identity: | 91.14 % |
Parental protein coverage: | 51.97 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VDKYTALVDAEEKEDVKSCAEFLNLSKARIEEYEKLLEKMRNIIPFDQMTIEDLNEAFPETKLDKTKYPY |
VDKYTALVDAEEKEDVKSCAEF.NL.K.RIEEYEKLLEKMRNII.FDQMT.EDLN.AFPETKLDKTKYPY | |
Retrocopy | VDKYTALVDAEEKEDVKSCAEFFNLLKVRIEEYEKLLEKMRNIILFDQMTTEDLNDAFPETKLDKTKYPY |
Parental | WPHQPIENL |
WPHQP.ENL | |
Retrocopy | WPHQPTENL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 129 .13 RPM |
SRP012922_cerebellum | 0 .14 RPM | 75 .47 RPM |
SRP012922_heart | 0 .46 RPM | 252 .91 RPM |
SRP012922_kidney | 0 .27 RPM | 137 .17 RPM |
SRP012922_liver | 0 .15 RPM | 44 .58 RPM |
SRP012922_lung | 0 .00 RPM | 56 .05 RPM |
SRP012922_quadricep_muscle | 0 .35 RPM | 190 .91 RPM |
SRP012922_spleen | 0 .00 RPM | 51 .05 RPM |