RetrogeneDB ID: | retro_ocun_972 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 18:39551780..39552001(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL13A | ||
| Ensembl ID: | ENSOCUG00000025258 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L13a [Source:HGNC Symbol;Acc:10304] |
| Percent Identity: | 74.67 % |
| Parental protein coverage: | 62.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GMLPHKTKRGQAA-LDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTA |
| G.LP.KT..GQAA.LDRL.VF.GIPPPYDKKK.MVVPAALK...LKPTRK.AYLG.LAHE.GW.YQA..A | |
| Retrocopy | GALPRKTQWGQAA<LDRLRVFNGIPPPYDKKKWMVVPAALKAMCLKPTRKPAYLGHLAHEAGWRYQAAAA |
| Parental | TLEEK |
| .LEE. | |
| Retrocopy | ILEEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .22 RPM | 131 .02 RPM |
| SRP017611_kidney | 0 .10 RPM | 349 .17 RPM |
| SRP017611_liver | 0 .31 RPM | 66 .52 RPM |