RetrogeneDB ID: | retro_dnov_996 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_132111:799..1243(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTP4A1 | ||
| Ensembl ID: | ENSDNOG00000018507 | ||
| Aliases: | None | ||
| Description: | protein tyrosine phosphatase type IVA, member 1 [Source:HGNC Symbol;Acc:9634] |
| Percent Identity: | 58.0 % |
| Parental protein coverage: | 86.98 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MARMNRPAPVEVTYKNMRFLITHNPTNATLSKFIEELKKYGVTTIVRVCEATYDTALVEKE-GIRVLDWP |
| MA.M..PA.V.VTYK.MRFLITHNP.NA.L.KFIE..KKYGVTT.VR.CE.TYDT.LVEK.....VLD.. | |
| Retrocopy | MA*MKCPATVKVTYKKMRFLITHNPSNAILIKFIE*FKKYGVTTAVRICEVTYDTVLVEKQ<STHVLDCL |
| Parental | FDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAQ-VLVLASVEGGMQ-EDAIQFIRQKWHG |
| F.DGAP..N.IVDDWL.LVKIK..E.P...IAVHCV...........LA..EGGM...D..Q..RQKW.. | |
| Retrocopy | FEDGAPQFNHIVDDWLNLVKIKSCEDPADSIAVHCVESWESSS>LVALALREGGMKYKDTVQIVRQKWRR |
| Parental | AFNSKHILYL |
| A.......Y. | |
| Retrocopy | AILKASNFYI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 17 .89 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 12 .23 RPM |
| SRP012922_heart | 0 .00 RPM | 18 .56 RPM |
| SRP012922_kidney | 0 .00 RPM | 13 .14 RPM |
| SRP012922_liver | 0 .00 RPM | 46 .44 RPM |
| SRP012922_lung | 0 .00 RPM | 14 .97 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 106 .45 RPM |
| SRP012922_spleen | 0 .00 RPM | 14 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000018507 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000008183 | 6 retrocopies | |
| Latimeria chalumnae | ENSLACG00000007183 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006572 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001162 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002777 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000018701 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000440 | 6 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006311 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000004938 | 4 retrocopies | |
| Procavia capensis | ENSPCAG00000001271 | 8 retrocopies | |
| Pongo abelii | ENSPPYG00000016743 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011771 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000046370 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000009956 | 14 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004129 | 6 retrocopies | |
| Vicugna pacos | ENSVPAG00000004277 | 9 retrocopies |