RetrogeneDB ID: | retro_ecab_783 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 4:35011541..35011832(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTP4A1 | ||
Ensembl ID: | ENSECAG00000022483 | ||
Aliases: | None | ||
Description: | protein tyrosine phosphatase type IVA, member 1 [Source:HGNC Symbol;Acc:9634] |
Percent Identity: | 56. % |
Parental protein coverage: | 57.8 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | APPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNS |
A.PSNQ.VDDWL.L...K..............AGL.RA..LVALALIEGGM.YEDAV.F.RQKR...F.S | |
Retrocopy | ALPSNQTVDDWLCL--VKMKFLKNLALYQSHIAGLRRALMLVALALIEGGMTYEDAVKFVRQKRSRTFKS |
Parental | KQLLYLEKYRPKMRLRFKDSNGHRNNCCVQ |
.QLLYLE.Y.PK..L...D...H.N.CC.Q | |
Retrocopy | RQLLYLE-YCPKIQLHCIDTSSHGNYCCCQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 17 .35 RPM |
SRP021940_cerebellum | 0 .00 RPM | 22 .59 RPM |
SRP021940_embryo | 0 .03 RPM | 45 .54 RPM |
SRP021940_placental_villous | 0 .00 RPM | 52 .97 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 14 .47 RPM |
SRP021940_testis | 0 .00 RPM | 92 .27 RPM |
Species | RetrogeneDB ID |
---|---|
Macaca mulatta | retro_mmul_1720 |
Canis familiaris | retro_cfam_593 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002275 | 3 retrocopies | |
Equus caballus | ENSECAG00000022483 | 6 retrocopies | |
Echinops telfairi | ENSETEG00000008183 | 6 retrocopies | |
Latimeria chalumnae | ENSLACG00000007183 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000006572 | 8 retrocopies | |
Myotis lucifugus | ENSMLUG00000001162 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002777 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000018701 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000440 | 6 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006311 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000004938 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000016743 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000015225 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000011771 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000046370 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000009956 | 14 retrocopies | |
Tursiops truncatus | ENSTTRG00000004129 | 6 retrocopies | |
Vicugna pacos | ENSVPAG00000004277 | 9 retrocopies |