RetrogeneDB ID: | retro_mmus_2594 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 5:107962133..107962312(+) | ||
Located in intron of: | ENSMUSG00000029270 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rpl37a | ||
Ensembl ID: | ENSMUSG00000046330 | ||
Aliases: | None | ||
Description: | ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068] |
Percent Identity: | 57.81 % |
Parental protein coverage: | 68.48 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTT-SAVTVKSAIRRLKELKDQ |
EIS.H.KYTC...GKT.M.RRA....HCGS.........WTYN...S.V..KSAIRRLK.LKDQ | |
Retrocopy | EIS*HTKYTCPIHGKTTMRRRANSMGHCGSVTENKG---WTYNIS<STVKLKSAIRRLKVLKDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 32 .45 RPM |
SRP007412_cerebellum | 0 .04 RPM | 19 .41 RPM |
SRP007412_heart | 0 .00 RPM | 39 .16 RPM |
SRP007412_kidney | 0 .02 RPM | 39 .62 RPM |
SRP007412_liver | 0 .00 RPM | 35 .64 RPM |
SRP007412_testis | 0 .00 RPM | 37 .83 RPM |
ENCODE library ID | Target | ChIP-Seq Peak coordinates |
---|---|---|
ENCFF001YIJ | POLR2A | 5:107960700..107961798 |
ENCFF001YJZ | POLR2A | 5:107960613..107962265 |
ENCFF001YKA | POLR2A | 5:107959629..107962237 |