RetrogeneDB ID: | retro_mmus_3367 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 9:92745942..92746164(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl37a | ||
| Ensembl ID: | ENSMUSG00000046330 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068] |
| Percent Identity: | 58.11 % |
| Parental protein coverage: | 80.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | YGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLK |
| .GASL.KMVK..E...HAKYT.SF..K.KMKR.A...WH.GSCM..VAG...TY......TVK.A.R.LK | |
| Retrocopy | HGASLVKMVKDTETN*HAKYTYSFLPKSKMKRQAMTTWHYGSCM*IVAGVPCTYSIICGATVKLATRKLK |
| Parental | ELKD |
| EL.D | |
| Retrocopy | ELSD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 32 .45 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 19 .41 RPM |
| SRP007412_heart | 0 .00 RPM | 39 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 39 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 35 .64 RPM |
| SRP007412_testis | 0 .00 RPM | 37 .83 RPM |