RetrogeneDB ID: | retro_ggor_2636 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 7:137524874..137525109(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37A | ||
Ensembl ID: | ENSGGOG00000014827 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.82 % |
Parental protein coverage: | 84.78 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCS-FCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTT |
..VGIVGKY.TRYG.SL.KMVKKIEISQ.AKY.CS.FCGKTKMKR.AVG.W.CGSCMKTV.......... | |
Retrocopy | QEVGIVGKYRTRYGVSLQKMVKKIEISQYAKYICS>FCGKTKMKR*AVGLWRCGSCMKTVTVSSCRNHIV |
Parental | SAVTVKSAI |
...T..SA. | |
Retrocopy | WTCTTTSAV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 158 .06 RPM |
SRP007412_cerebellum | 0 .00 RPM | 165 .87 RPM |
SRP007412_heart | 0 .00 RPM | 136 .09 RPM |
SRP007412_kidney | 0 .04 RPM | 363 .87 RPM |
SRP007412_liver | 0 .00 RPM | 317 .93 RPM |
SRP007412_testis | 0 .62 RPM | 268 .74 RPM |