RetrogeneDB ID: | retro_tbel_1992 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_614:64486..64728(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37A | ||
| Ensembl ID: | ENSTBEG00000007409 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37a [Source:HGNC Symbol;Acc:10348] |
| Percent Identity: | 75.61 % |
| Parental protein coverage: | 88.04 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | VGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVK |
| ..K.GT.YGASL.KMVKK..ISQHAKYTCS..GKTKMKR.A.G.WH.GSC.KTV.GGAWTYNTT.A.TVK | |
| Retrocopy | IDKHGTCYGASLQKMVKKSKISQHAKYTCSLGGKTKMKR*ASGAWHYGSCTKTVTGGAWTYNTTLAITVK |
| Parental | SAIRR-LKELKD |
| SAIRR...ELKD | |
| Retrocopy | SAIRR<AEELKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |