RetrogeneDB ID:

retro_mmus_2768

Retrocopy
location
Organism:Mouse (Mus musculus)
Coordinates:6:99215238..99215427(+)
Located in intron of:ENSMUSG00000030067
Retrocopy
information
Ensembl ID:None
Aliases:None
Status:NOVEL
Parental gene
information
Parental gene summary:
Parental gene symbol:Rpl37a
Ensembl ID:ENSMUSG00000046330
Aliases:None
Description:ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068]


Retrocopy-Parental alignment summary:






>retro_mmus_2768
AAAACTAAAATCAGCCAGCATGCTAAGTATATCCATTCCTTCTATGGCTAGACCAAGGTGAAGAGACAGGCCATTGACAT
CTGGCCCTGTGGTTCCTACATGAAAACAGTGGCTAGCAGGGTGCTATACACCCCGATGTCAGCCAAGACTCCCGCCAGCA
GACACAGGGAAATGAATGGCTATTTAGAC

ORF - retro_mmus_2768 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 51.56 %
Parental protein coverage: 69.57 %
Number of stop codons detected: 1
Number of frameshifts detected 0


Retrocopy - Parental Gene Alignment:

ParentalKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD
K..ISQHAKY..SF.G.TK.KR.A..IW.CGS.MKTVA.....Y...SA.T..S..R......D
RetrocopyKTKISQHAKYIHSFYG*TKVKRQAIDIWPCGSYMKTVASRV-LYTPMSAKTPASRHREMNGYLD

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)

Expression validation based on RNA-Seq data:
Library Retrocopy expression Parental gene expression
SRP007412_brain 0 .00 RPM 32 .45 RPM
SRP007412_cerebellum 0 .00 RPM 19 .41 RPM
SRP007412_heart 0 .00 RPM 39 .16 RPM
SRP007412_kidney 0 .00 RPM 39 .62 RPM
SRP007412_liver 0 .00 RPM 35 .64 RPM
SRP007412_testis 0 .00 RPM 37 .83 RPM
RNA Polymerase II actvity near the 5' end of retro_mmus_2768 was not detected
No EST(s) were mapped for retro_mmus_2768 retrocopy.
No TSS is located nearby retro_mmus_2768 retrocopy 5' end.
retro_mmus_2768 was not experimentally validated.

Retrocopy orthology:
Retrocopy retro_mmus_2768 has 0 orthologous retrocopies within eutheria group .


Parental genes homology:
Parental genes homology involve 17 parental genes, and 243 retrocopies.

Species Parental gene accession Retrocopies number
Bos taurus ENSBTAG000000038469 retrocopies
Choloepus hoffmanni ENSCHOG0000000400014 retrocopies
Felis catus ENSFCAG0000002701021 retrocopies
Homo sapiens ENSG000001977566 retrocopies
Gorilla gorilla ENSGGOG000000148275 retrocopies
Latimeria chalumnae ENSLACG000000115781 retrocopy
Monodelphis domestica ENSMODG000000254859 retrocopies
Mus musculus ENSMUSG00000046330 18 retrocopies
Nomascus leucogenys ENSNLEG000000072768 retrocopies
Ochotona princeps ENSOPRG0000000443610 retrocopies
Petromyzon marinus ENSPMAG000000000011 retrocopy
Pongo abelii ENSPPYG000000258781 retrocopy
Pan troglodytes ENSPTRG000000290296 retrocopies
Sarcophilus harrisii ENSSHAG0000001341710 retrocopies
Tupaia belangeri ENSTBEG00000007409108 retrocopies
retro_tbel_1089, retro_tbel_1095, retro_tbel_1113, retro_tbel_1168, retro_tbel_1198, retro_tbel_1204, retro_tbel_1218, retro_tbel_1244, retro_tbel_1345, retro_tbel_1352, retro_tbel_141, retro_tbel_1434, retro_tbel_1466, retro_tbel_1471, retro_tbel_148, retro_tbel_1489, retro_tbel_1502, retro_tbel_151, retro_tbel_1534, retro_tbel_1683, retro_tbel_1714, retro_tbel_1807, retro_tbel_1835, retro_tbel_1838, retro_tbel_1922, retro_tbel_194, retro_tbel_1973, retro_tbel_1992, retro_tbel_1995, retro_tbel_2002, retro_tbel_2044, retro_tbel_2083, retro_tbel_209, retro_tbel_2101, retro_tbel_2178, retro_tbel_2190, retro_tbel_223, retro_tbel_2381, retro_tbel_2631, retro_tbel_2699, retro_tbel_2705, retro_tbel_2725, retro_tbel_2780, retro_tbel_2813, retro_tbel_2844, retro_tbel_285, retro_tbel_286, retro_tbel_2985, retro_tbel_3022, retro_tbel_3048, retro_tbel_3108, retro_tbel_3118, retro_tbel_3211, retro_tbel_3490, retro_tbel_350, retro_tbel_3565, retro_tbel_3593, retro_tbel_3632, retro_tbel_3641, retro_tbel_3651, retro_tbel_3757, retro_tbel_3784, retro_tbel_3837, retro_tbel_3901, retro_tbel_3910, retro_tbel_3912, retro_tbel_3916, retro_tbel_3919, retro_tbel_3955, retro_tbel_3969, retro_tbel_3970, retro_tbel_4055, retro_tbel_4098, retro_tbel_4099, retro_tbel_4117, retro_tbel_412, retro_tbel_4148, retro_tbel_4188, retro_tbel_420, retro_tbel_4244, retro_tbel_4382, retro_tbel_4452, retro_tbel_4522, retro_tbel_4524, retro_tbel_458, retro_tbel_4586, retro_tbel_4588, retro_tbel_4613, retro_tbel_4703, retro_tbel_472, retro_tbel_500, retro_tbel_566, retro_tbel_574, retro_tbel_583, retro_tbel_590, retro_tbel_594, retro_tbel_595, retro_tbel_622, retro_tbel_648, retro_tbel_681, retro_tbel_739, retro_tbel_767, retro_tbel_790, retro_tbel_834, retro_tbel_870, retro_tbel_893, retro_tbel_907, retro_tbel_998,
Tarsius syrichta ENSTSYG0000000425811 retrocopies
Vicugna pacos ENSVPAG000000025295 retrocopies



Copyright © RetrogeneDB 2014-2017