RetrogeneDB ID: | retro_mmus_2768 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 6:99215238..99215427(+) | ||
Located in intron of: | ENSMUSG00000030067 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rpl37a | ||
Ensembl ID: | ENSMUSG00000046330 | ||
Aliases: | None | ||
Description: | ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068] |
Percent Identity: | 51.56 % |
Parental protein coverage: | 69.57 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD |
K..ISQHAKY..SF.G.TK.KR.A..IW.CGS.MKTVA.....Y...SA.T..S..R......D | |
Retrocopy | KTKISQHAKYIHSFYG*TKVKRQAIDIWPCGSYMKTVASRV-LYTPMSAKTPASRHREMNGYLD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 32 .45 RPM |
SRP007412_cerebellum | 0 .00 RPM | 19 .41 RPM |
SRP007412_heart | 0 .00 RPM | 39 .16 RPM |
SRP007412_kidney | 0 .00 RPM | 39 .62 RPM |
SRP007412_liver | 0 .00 RPM | 35 .64 RPM |
SRP007412_testis | 0 .00 RPM | 37 .83 RPM |