RetrogeneDB ID: | retro_chof_1744 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_37335:13134..13383(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37A | ||
| Ensembl ID: | ENSCHOG00000004000 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37a [Source:HGNC Symbol;Acc:10348] |
| Percent Identity: | 51.81 % |
| Parental protein coverage: | 89.13 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVG-IWHCGSCMKTVAGGAW |
| .AK...K..I..K..T.Y..SLRKMV...EI.Q.A...CSFC.KTKMK..AVG..WH.GS..K.VAG.A. | |
| Retrocopy | IAKHLVKNAIISK*QTCYVVSLRKMVQNFEIHQRAMCSCSFCCKTKMKSLAVGSSWHSGSYRKRVAGSAK |
| Parental | TYNTTSAVTVKSA |
| T....S.V.VK.. | |
| Retrocopy | TSTNISVVIVKTS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |