RetrogeneDB ID: | retro_mmus_3603 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:42888726..42888953(-) | ||
| Located in intron of: | ENSMUSG00000016150 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000083098 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl23 | ||
| Ensembl ID: | ENSMUSG00000071415 | ||
| Aliases: | Rpl23, 2810009A01Rik | ||
| Description: | ribosomal protein L23 [Source:MGI Symbol;Acc:MGI:1929455] |
| Percent Identity: | 74.03 % |
| Parental protein coverage: | 54.29 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | VKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADLW-PRIA |
| VKKGKPE.RKK.HPAVVI.Q.K...RKDGVFL.FE..A.V.VNN.GEMK.SAITGPVAKEC.DLW...IA | |
| Retrocopy | VKKGKPEVRKKIHPAVVI*QQKLH*RKDGVFL*FENDARVTVNNNGEMKDSAITGPVAKECEDLW<ASIA |
| Parental | SNAGSIA |
| SNA..IA | |
| Retrocopy | SNADRIA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 71 .37 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 60 .14 RPM |
| SRP007412_heart | 0 .00 RPM | 126 .20 RPM |
| SRP007412_kidney | 0 .00 RPM | 162 .24 RPM |
| SRP007412_liver | 0 .00 RPM | 144 .65 RPM |
| SRP007412_testis | 0 .00 RPM | 107 .21 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_2981 |