RetrogeneDB ID: | retro_cjac_1375 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 15:6923962..6924164(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPLP1 | ||
| Ensembl ID: | ENSCJAG00000032919 | ||
| Aliases: | None | ||
| Description: | ribosomal protein, large, P1 [Source:HGNC Symbol;Acc:10372] |
| Percent Identity: | 64.71 % |
| Parental protein coverage: | 58.77 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVG-AGGPAP |
| .S.L.CI.SAL.L.DDEVTVTED.INAL.KA..V.VEP..PGLF...LA.VNIGS.IC..G..G.P.P | |
| Retrocopy | ISKLPCISSALTLNDDEVTVTEDTINALTKAPAVTVEPVRPGLFVRTLASVNIGSYICHGG>TGRPTP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 107 .48 RPM |
| SRP051959_heart | 0 .00 RPM | 102 .58 RPM |
| SRP051959_kidney | 0 .04 RPM | 120 .09 RPM |
| SRP051959_liver | 0 .02 RPM | 96 .48 RPM |
| SRP051959_lung | 0 .05 RPM | 121 .91 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 168 .97 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 176 .65 RPM |
| SRP051959_spleen | 0 .00 RPM | 171 .41 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2897 |