RetrogeneDB ID: | retro_ecab_1047 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | Un0613:3213..3453(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS13 | ||
Ensembl ID: | ENSECAG00000014928 | ||
Aliases: | None | ||
Description: | ribosomal protein S13 [Source:HGNC Symbol;Acc:10386] |
Percent Identity: | 66.25 % |
Parental protein coverage: | 52.98 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNK |
MG....PGK.LSQ.ALP...S.PTWLK..SDD.KE..YKLA.KGLTPSQ..V.LR.SHG..QV.FV.GNK | |
Retrocopy | MGHTYVPGKDLSQ*ALPLCHSIPTWLKMMSDDTKEHFYKLANKGLTPSQADVVLRNSHGTEQVCFVRGNK |
Parental | ILRILKSKGL |
.LRIL..KGL | |
Retrocopy | TLRILQYKGL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 562 .67 RPM |
SRP021940_cerebellum | 0 .00 RPM | 255 .77 RPM |
SRP021940_embryo | 0 .00 RPM | 354 .97 RPM |
SRP021940_placental_villous | 0 .00 RPM | 260 .67 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 341 .42 RPM |
SRP021940_testis | 0 .00 RPM | 157 .43 RPM |