RetrogeneDB ID: | retro_sscr_264 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 11:37305249..37305489(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS13 | ||
Ensembl ID: | ENSSSCG00000013381 | ||
Aliases: | None | ||
Description: | 40S ribosomal protein S13 [Source:UniProtKB/Swiss-Prot;Acc:P62279] |
Percent Identity: | 82.72 % |
Parental protein coverage: | 52.94 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWK |
ILRILKSKGLA..LPEDL.HLI.KAVA..KHLERNRKDKDAKF.LILIES.IH.LA.YYKT.RVL.PNWK | |
Retrocopy | ILRILKSKGLA-NLPEDLHHLIEKAVAIQKHLERNRKDKDAKFHLILIESSIHLLA*YYKTERVLAPNWK |
Parental | YESSTASALVA |
YESS.ASAL.A | |
Retrocopy | YESSIASALTA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 387 .97 RPM |
SRP014902_testis | 0 .00 RPM | 276 .95 RPM |
SRP018288_heart | 0 .00 RPM | 294 .10 RPM |
SRP018288_kidney | 0 .00 RPM | 246 .76 RPM |
SRP018288_liver | 0 .00 RPM | 239 .22 RPM |
SRP018288_lung | 0 .00 RPM | 108 .85 RPM |
SRP018856_adipose | 0 .00 RPM | 271 .12 RPM |
SRP035408_brain | 0 .00 RPM | 90 .96 RPM |
SRP035408_liver | 0 .00 RPM | 76 .62 RPM |