RetrogeneDB ID: | retro_ttru_1564 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_116402:532470..532708(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL22 | ||
| Ensembl ID: | ENSTTRG00000010488 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L22 [Source:HGNC Symbol;Acc:10315] |
| Percent Identity: | 55.95 % |
| Parental protein coverage: | 62.5 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | KKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIK-VNGKAGNLGGGVVTIERSK-SKITVTSEVPFS-KR |
| .KQV.K....C..PVEDG..DAA.FEQ.LQ.RIK.V..KA..L.....T.ER.K..KITV..EVPFS... | |
| Retrocopy | RKQVVKASFGCGPPVEDGVEDAAHFEQCLQKRIK<VHCKADHLAKNIITTERTK>AKITVSLEVPFS<LK |
| Parental | YLKYLTK-KYLKKN |
| Y..YLTK..YLKK. | |
| Retrocopy | YVNYLTK<RYLKKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |